SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Callithrix jacchus 76_3.2.1 > ENSCJAP00000042948

Domain assignment for ENSCJAP00000042948 from Callithrix jacchus 76_3.2.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSCJAP00000042948
Domain Number 1	Region: 192-229
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.000000000000222
Family	CCCH zinc finger	0.0018
Further Details:

Domain Number 2	Region: 160-186
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.000000000419
Family	CCCH zinc finger	0.0013
Further Details:

Domain Number 3	Region: 133-157
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.000000549
Family	CCCH zinc finger	0.0045
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCJAP00000042948 Gene: ENSCJAG00000016492 Transcript: ENSCJAT00000052288
Sequence length	232
Comment	pep:known_by_projection chromosome:C_jacchus3.2.1:14:16898582:16919187:-1 gene:ENSCJAG00000016492 transcript:ENSCJAT00000052288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	FGNSTISPKSSLHRKSRSKDYDVYSDKDICNQEPEDNFAKELQQYIQAREMANAAQPEES MKKAGVKDIPQAAKQKNKNLKAGHKNGKQKKMKRKWPGTGNKGSNSQEEDGKPKEKQQHL SQAFINQHTVERKGKQICKYFLERKCIKGDQCKFDHDAEIEKKKEMCKFYVQGYCTRGEN CLYLHNILYQIFYHTGTKCYQGEYCKFSHAPLTPETQELLAKVLDTEKTSCK
Download sequence
Identical sequences	F6VMK1 ENSCJAP00000042948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]