SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043108 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043108
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000741
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000043108
Domain Number - Region: 238-337
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0366
Family Apolipoprotein A-I 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043108   Gene: ENSCJAG00000001482   Transcript: ENSCJAT00000054414
Sequence length 482
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:122148868:122152738:1 gene:ENSCJAG00000001482 transcript:ENSCJAT00000054414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQSRHAKDLALLDISESVLIYLGFERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGD
IQAEMVVRLQAKTGGWAWIYCLLYSEGPEGPITANNYPISDMEAWSLRQQLNSEDNQAAY
VLGTPTMLPSFPENILSQEQCSSTNPLFTAALGAPRSTSFPSAPELSVVSASEELPRPSK
ELDFSYLAFPSGPEPSLQAELSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPAPSSTL
QEQLTPSTATFSDQLTPSSATFPDPLTSPLQGQLTETSARSYEDQLTPCTSTFPDQLLPS
TATFPEPVGSPAHEQLTPPSTAFQAHLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLP
PSPSSPGNGDCTLLALAQLRGPLSVDVPLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRL
IQQISQLAQGMDRPFSAEAGTGGLEPLGGLEPLDSNLSLSGAGPCAQPGPETLEMPGVGL
PG
Download sequence
Identical sequences F7IPM1
ENSCJAP00000043108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]