SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043207 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043207
Domain Number 1 Region: 184-286
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.6e-43
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000375
Further Details:      
 
Domain Number 2 Region: 89-218
Classification Level Classification E-value
Superfamily Translation proteins 5.41e-34
Family Elongation factors 0.00000595
Further Details:      
 
Domain Number 3 Region: 6-107
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000135
Family G proteins 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043207   Gene: ENSCJAG00000017492   Transcript: ENSCJAT00000007602
Sequence length 308
Comment pep:novel chromosome:C_jacchus3.2.1:6:5351314:5353021:1 gene:ENSCJAG00000017492 transcript:ENSCJAT00000007602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGW
KVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKP
GMVVVFSPVNVTTEVKSVEMHHEALSEALPEDNVGFNVKNVSVKDVRRGNVAGDSKNDPP
MEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFL
KSGDAAIVDMVPGKPMCVESFSDYPPLGCFAVRDMRQTVSMGVIKAGDKKAAGAGKVTKS
AQKAQKAK
Download sequence
Identical sequences F7ICT5
ENSCJAP00000043207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]