SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043340 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043340
Domain Number 1 Region: 65-381
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-127
Family Transglutaminase core 0.0000000000105
Further Details:      
 
Domain Number 2 Region: 389-504
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.54e-35
Family Transglutaminase, two C-terminal domains 0.000000981
Further Details:      
 
Domain Number 3 Region: 505-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.54e-27
Family Transglutaminase, two C-terminal domains 0.00000283
Further Details:      
 
Domain Number 4 Region: 3-63
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000735
Family Transglutaminase N-terminal domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043340   Gene: ENSCJAG00000021503   Transcript: ENSCJAT00000060721
Sequence length 606
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:32149078:32187804:-1 gene:ENSCJAG00000021503 transcript:ENSCJAT00000060721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEELILERCDLELESNGRDHHTADLCQEKLVVRRGQPFRLTLHFEGRNYEASVDSLTFS
VVTVDAVYLDSEEERQEYILTQQGFIYQGSAKFIKSVPWNFGQFEDGILDICLMLLDVNP
KFVKDAGRDCSRRSSPIYIGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMFWIGSVDIL
RRWRNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFG
EIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPTPQEKSEGTYCCGPVPVRAIKE
GDLSTKYDAPFVFAEVNADVVDWIQQDDGSMHKSVNRSLVVGMKISTKSVGRDEREDITH
TYKYPEGSSEEREAFTRANHLNKLAEKEEAGMAMRIRVGQSMNMGSDFDVFAHITNNTTE
EHACRLLLCARTVSYNGVLGPECGTKDLLNLTLEPFSEKSIPLRILYEKYCDCLTESNLI
KVRGLLVEPATNSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLRNPLTVSLAGCI
FTVEGAGLTEEQKTVEIQDPVEAGEEVKVRVDLLPLHVGRHKLVVNFESDKLKAVKGFRN
VIIGPA
Download sequence
Identical sequences F7HLU3
ENSCJAP00000043340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]