SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043835 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043835
Domain Number 1 Region: 541-570,650-729
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000981
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043835   Gene: ENSCJAG00000003142   Transcript: ENSCJAT00000052710
Sequence length 746
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:24315244:24323877:-1 gene:ENSCJAG00000003142 transcript:ENSCJAT00000052710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRDMQALLPATRAMELRKQDYHMERPLLNQEHLEELGHWGSAPRTRQWRTWLQCSRARA
HALLLQRLPILVWLPRYPVRDWLLGDLLSGLSVAIMQLPQDLPSRPHCYHSTLGLAYALL
AGLPPVFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQALNDSTINET
ARDAARVQVASTLSVLVGLFQVGLGLVHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYV
FELHLSSHSGPLSLIYTVLEVCWKLPDSKVGTMVTAAVAGVVLVLVKLLNDKLQQQLPMP
IPGELLTLIGATSISYGMDLKHRFKVSVVGNIPTGLVSPVAPNAQLFSKLMGSAFTIALV
GFAIAISLGKIFALRHSYRVDSNQELVALGLSNLIGGIFRCFPVSCSMSRSLVQESTGGN
SQVAGAVSSFFILLIIVKLGELFHDLPKAVLAAIVIVNLKGMLRQLSDICSLWKANRADL
LIWLVTFIATILLNLDLGLVAAVIFSLLLVVVRTQRPHYSILGQVPDTDIYRDVAEYSEA
KEVPGVKVFRSSATVYFANAEFYSDALKQRCGVDVDLLISQKKKLLKKQEQLKLKQLQKE
KKLQKQAGPLLAACLAPHQVSPGDKMEDATASGQEDSKAPDVSTLKALGLPQPDFHSLIL
DLSALSFVDTVCLKSLKNIFRDFREIEVEVYMAACHSPVVSQLEAGHFFDASVTKKHLFA
SVHDAVTFALQHPRPVTDSPVSVTRL
Download sequence
Identical sequences F7IC95
ENSCJAP00000043835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]