SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043915 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000043915
Domain Number - Region: 129-229
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0046
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043915   Gene: ENSCJAG00000013127   Transcript: ENSCJAT00000057830
Sequence length 509
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:166263863:166335643:1 gene:ENSCJAG00000013127 transcript:ENSCJAT00000057830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYLVCKRKLESKKEALLILSKELDTCQQERDQYKLMANQLRERHQSLKKKYRELIDGDPS
LPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRLGDEEI
GVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERLNQELN
HILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKGQGKS
SSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQT
NKILGNRVAELEKKLRTLEVSGLWSLPGGKDTILFSDPTLPSGQRSRSPLLKFVEQPPEN
KVDPKDGEAQKQEGDESCAAAEALTAPEDARRPTVNSPPNQSCGNQSKLFHSSLPQLPCE
GEVNSLGREIIKLTKEQAAAELEEVRRESPIEGHRSETRPALQGLAAQGKLPTSHLDSFE
TSQPAAEAPALEDGEEIPEGSGMRSTTKT
Download sequence
Identical sequences F7HVV9
ENSCJAP00000044656 ENSCJAP00000043915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]