SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044142 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044142
Domain Number 1 Region: 434-760
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.16e-105
Family PDEase 0.00000135
Further Details:      
 
Domain Number 2 Region: 162-263
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.99e-18
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000044142
Domain Number - Region: 36-108
Classification Level Classification E-value
Superfamily CheY-like 0.00121
Family CheY-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044142   Gene: ENSCJAG00000019876   Transcript: ENSCJAT00000054938
Sequence length 772
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:130938477:131156690:-1 gene:ENSCJAG00000019876 transcript:ENSCJAT00000054938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFL
DKHHEIIVIDHRQTQNFDAEAVCRSIRATNPSEHTVILAVVSRVSDDHEEASVLPLLHAG
FNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQY
VNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGD
SIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNR
RKESIDVKSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAE
ALDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKSVTSSYSH
LSLSINMKNLEMCTRATVDNEESWDFNIFELEAVTHKRPLVYLGLKVFTRFGVCEFLNCS
ETTLRAWFQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAAT
VHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHY
RTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPAGKNFPENQILIK
RMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQ
ISFIDYFITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDS
Download sequence
Identical sequences F7GAJ4
ENSCJAP00000044142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]