SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044471 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044471
Domain Number 1 Region: 183-284
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.58e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 37-148
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.16e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044471   Gene: ENSCJAG00000019202   Transcript: ENSCJAT00000062392
Sequence length 767
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:86715841:86772321:1 gene:ENSCJAG00000019202 transcript:ENSCJAT00000062392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKY
MGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRG
RTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDS
KTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQ
VTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTEC
VLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTE
TDDQQLEEVPLYNDVMLPSSNEKLQNINLSMSPLATSETPKPLRSSADPALNQEVALKLE
PNPESLELSFTMPQIQDQPPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKL
FAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTV
TVFQQTQIQELTSNATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPY
RDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRATVPEEELNPKILALQNAQRK
RKIEHDGSLFQAVGIGTLLQQPDDHATTTSLSWKRVKGCKSSEQNGMEQKAIILIPSDLA
CRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences F7HBS4
ENSCJAP00000044471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]