SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044473 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044473
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000000000643
Family Cystathionine synthase-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044473   Gene: ENSCJAG00000012322   Transcript: ENSCJAT00000054129
Sequence length 124
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:76610035:76710329:-1 gene:ENSCJAG00000012322 transcript:ENSCJAT00000054129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDIVGASENEIALMNALTINLHLLLLSFFKPTTKRYKILLEAKAFPSDHYAIESQLQLH
GLNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKA
GQAK
Download sequence
Identical sequences F7HBS2
ENSCJAP00000044473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]