SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044589 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044589
Domain Number 1 Region: 81-153
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044589   Gene: ENSCJAG00000007092   Transcript: ENSCJAT00000052271
Sequence length 384
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:17619836:17621983:-1 gene:ENSCJAG00000007092 transcript:ENSCJAT00000052271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTPPPQSLLSRDHWIFAQGWGWGHSDSHSTSPASSSDSSGSCPCDGARGLPQPAVLDR
GSQAAEAAPTTPRRARSGPAGGQRQSASEREKLRMRTLARALQELRRFLPPSVVPAGQSL
TKIETLRLAIRYIGHLSAVLGLSEESLQRRRLQRGEAGSSRGCPLCPDGGPAQAQTQTQR
EGLELGLGLGQGQGQGRGRVVRSWASWGSSPACPGARAAPERLGSGVHDADPWATPPYCP
KIQSPPYSSQGTTSDASLWTPPQSCPWTQPSPEPRNPPAPWTTPPATLELATVYQGLSVS
PESCLSLGTPSLLPHPSCQRLQPQTPWGCWSHSTEVLPTSEDQGQGAAFQLSEASPPQSS
ALRFSGCPELWQEDLEGARVSIFY
Download sequence
Identical sequences F7FI18
ENSCJAP00000013156 ENSCJAP00000044589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]