SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044736 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000044736
Domain Number - Region: 17-66
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0453
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044736   Gene: ENSCJAG00000033850   Transcript: ENSCJAT00000059514
Sequence length 107
Comment pep:novel chromosome:C_jacchus3.2.1:11:47936269:47938175:-1 gene:ENSCJAG00000033850 transcript:ENSCJAT00000059514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKAEYQKMPVFLHEEGQHNLEMLKKKGKDIFRQLTESKAKMVHKREILRGMYEELKEMCH
KPHMELLQVRTHNVKQSECILLHMPQPVNPQLSAEPITGLMDRLNQF
Download sequence
Identical sequences F7GJ87
ENSCJAP00000044736 ENSCJAP00000044736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]