SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044764 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044764
Domain Number 1 Region: 217-372
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-22
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 619-733
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-20
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-18
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 126-235
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000118
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 5 Region: 696-842
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000018
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000044764
Domain Number - Region: 495-678
Classification Level Classification E-value
Superfamily Tropomyosin 0.00353
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044764   Gene: ENSCJAG00000012842   Transcript: ENSCJAT00000057926
Sequence length 982
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:153039024:153096711:-1 gene:ENSCJAG00000012842 transcript:ENSCJAT00000057926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGERLAKASHESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSILR
TWLAHIESELAKPIVYDSCNSEEIQRKLNEQQELQRDIEKHSTGVASVLNLCEVLLHDCD
ACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKIS
ERTAAFPSSSGVIYTVAKEELKKFEAFQRQVHECLTQLELINKQYRRLARENRTDSACSL
KQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFS
ECDVQAKIKQLKAFQQEISLNHNKIEQIIAQGEQLIEKSEPLDAAVIEEELDELRRYCQE
VFGRVERYHKKLIRLPLPDDEHDLSDRELELEDSAALSDLHWQDRSADSVLSPQPSSNPS
LSLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAVSRALPSEDEDGQDDKDFYL
RGAVGLSDVMIPESPEAYVKLTENAIKNTSGDHSALESQIRQLGRALDESRFQIQQTENI
IRSKTPTGPELDTSYKGYMKLLGECSGSIDSVKRLEHKLKEEEESLPGFVNLHSTETQMA
GVIDRWELLQAQALSKELRMKQNLQKWQQFNSDLNSIWAWLGDTEEELEHLQHLELSTDI
HTIELQIKKLKELQKAVDHRKAIILSINLCSPEFTQADSKESQDLQDRLSQMNGRWDRVC
SLLEEWRGLLQDALMQCQGFHEMSHGLLLMLENIDRRKNEIVPIDPNLDAEVLQDHHKQL
MQIRRELLESQLRVASLQDMSCQLLVNAEGADCLEAKEKVHVIGNRLKLLLKEVSRHIKE
LEKLLDVSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNRQKTPRGKCSLSQPGPSVSSP
HSRSTKGGFDSSLSEPGPARSGRAFLFRVLRAALPLQLLLLLLIGLACLVPMSEEDYSCA
LSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences F7FVZ9
ENSCJAP00000044764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]