SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045014 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045014
Domain Number 1 Region: 89-132
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000314
Family Hairy Orange domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045014   Gene: ENSCJAG00000000434   Transcript: ENSCJAT00000060514
Sequence length 223
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:154777306:154778777:-1 gene:ENSCJAG00000000434 transcript:ENSCJAT00000060514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSAPGPDRVGREDEDWWETRGDRKVRAGAVGERAGGRPSRSARSVHRLFRAHLQVKV
ENSEGPEQTVRRVQDELRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATV
SAELLNHLLESMPLREGSSFQDLLGDALVGPPGAPRRSGWPAGGAPGSPVPSPPGPGDDL
CSDLEEAPEAELSRAPAEGPDLVPAALSRLTAAQIAHSVWRPW
Download sequence
Identical sequences F6U5X1
ENSCJAP00000045014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]