SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045091 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045091
Domain Number 1 Region: 355-663
Classification Level Classification E-value
Superfamily Folate-binding domain 2.35e-81
Family Aminomethyltransferase folate-binding domain 0.0000684
Further Details:      
 
Domain Number 2 Region: 2-158,263-347
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.71e-36
Family FAD-linked reductases, N-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 160-262
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.45e-19
Family L-aminoacid/polyamine oxidase 0.046
Further Details:      
 
Domain Number 4 Region: 666-758
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000245
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045091   Gene: ENSCJAG00000014501   Transcript: ENSCJAT00000056157
Sequence length 779
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:20:28200680:28244450:-1 gene:ENSCJAG00000014501 transcript:ENSCJAT00000056157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYSNKLYHQLEQETGIQTGYTRTGSVFLAQTQDRLISLKRINSRLNVIGIPSEIISPK
KVAELHHLLNVHDLVGAMHVPEDAVVSSADVALALASAASQNGVQIYDQTSVLHVMVKKG
QVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEPISIPLHACEHFYLLTRPLETPLQSS
TPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLL
RRMPELESLEIMKLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGKYLA
EWMVHGYPSENVWELDLKRFGALQSSRTFLRHRVMEVMPLIYDLKVPRWDFQTGRQLRTS
PLYDRLDAQGARWMEKHGFERPKYFVPPDKDLLALEQSKTFYKPDWFDIVESEVKCCKEA
VCVIDMSSFTKFEITSTGDQALEVLQYLFSNDLDVPVGHIVHTGMLNEVGGYENDCSIAR
LSKRSFFMISPTDQQVHCWAWLKKHMPKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSY
APMTPDHFPSLFCKEMSVGYANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMNVGQKY
GIRNAGYYALRSLRIEKFFAFWGQDINNLTTPLECGRESRVKLEKGMDFIGRDALLQQKQ
NGVYKRFTMFILDDHDTDLDLWPWWGEPIYRNGQYVGKTTSSAYSYSLERHVCLGFVHNF
SEDTGEEQVVTADFINRGEYEIDIAGYRFQAKAKLYPVASLFTHKRRKDDMELSDLHGK
Download sequence
Identical sequences F6T827
ENSCJAP00000045091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]