SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045252 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045252
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.72e-62
Family GDI-like N domain 0.000000000262
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000107
Family GDI-like N domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045252   Gene: ENSCJAG00000020512   Transcript: ENSCJAT00000054802
Sequence length 445
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:4309045:4355136:-1 gene:ENSCJAG00000020512 transcript:ENSCJAT00000054802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKIPG
SPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPMKTTMREVYKKFDLGQD
VIDFTGHALALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTVETK
EPEKEIRPALELLEPIEQKFISISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI
YKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences F6QGU6
ENSCJAP00000038138 XP_002750065.1.60252 ENSCJAP00000038138 ENSCJAP00000045252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]