SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045333 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045333
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.31e-22
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045333   Gene: ENSCJAG00000011260   Transcript: ENSCJAT00000063234
Sequence length 132
Comment pep:novel chromosome:C_jacchus3.2.1:7:33710734:33729176:1 gene:ENSCJAG00000011260 transcript:ENSCJAT00000063234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPLLLAITKRNVQIVEFLLSKKANANAVNEYKCTALILAVYHRSSEIVGMLLQQNVDIYA
EDMRGLTAERYAAAYGFDEILEQLLDYKQKTSKYPQNSNPEETSEGTPDKAAPLAERMPD
EATPVVERMPEE
Download sequence
Identical sequences F6T6R7
ENSCJAP00000045333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]