SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045501 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000045501
Domain Number - Region: 191-245
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00785
Family Frizzled cysteine-rich domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045501   Gene: ENSCJAG00000019058   Transcript: ENSCJAT00000054088
Sequence length 506
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:156973911:156981097:1 gene:ENSCJAG00000019058 transcript:ENSCJAT00000054088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGEHLRICPQGYTCCTSEMEENLANRSRTELETSLRDSSRALQAMLATQLRSFDDHFQHL
LNDSERALQDAFPGAFGELYAQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERL
FKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVV
RKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLL
GLDSMVLITDKFWGASGVESVIGGVHMWLAEAINSLQDNRDTLTAKVIQGCGNPKVNPQG
PGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASD
DRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYN
GNDVDFQDASDDGSGSGSGDGCPDDLCGRKNSRKSSSSRTPLTHALPGLSEQEGQKTSAA
SCPQPPSFLLPLLLALALTVARPRWR
Download sequence
Identical sequences F6U1X4
ENSCJAP00000045501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]