SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045609 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045609
Domain Number 1 Region: 14-339
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.8e-72
Family Pancreatic carboxypeptidases 0.00000124
Further Details:      
 
Domain Number 2 Region: 339-378
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000549
Family Carboxypeptidase regulatory domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045609   Gene: ENSCJAG00000009311   Transcript: ENSCJAT00000052185
Sequence length 382
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:25903187:26043159:-1 gene:ENSCJAG00000009311 transcript:ENSCJAT00000052185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDN
PGVHEPGEPEFKYIGNMHGNEAVERELLFFLAQYLCNEYQKGNETIVNLIHNTRIHIMPS
LNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMK
KIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDA
IFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNC
FEITVELSCEKFPPEETLKTYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVE
GIDHDVTSAKDGDYWRLLTWKL
Download sequence
Identical sequences F6R998
ENSCJAP00000045609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]