SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045743 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045743
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-40
Family Transglutaminase core 0.0000279
Further Details:      
 
Domain Number 2 Region: 135-246
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-31
Family Transglutaminase, two C-terminal domains 0.00055
Further Details:      
 
Domain Number 3 Region: 247-346
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.18e-29
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045743   Gene: ENSCJAG00000006740   Transcript: ENSCJAT00000061244
Sequence length 375
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:48287780:48302510:-1 gene:ENSCJAG00000006740 transcript:ENSCJAT00000061244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDK
VYWQRQDDGSFKIVYVEEKAIGTLVVTKAIGSNMREDITYLYKHPEGSDAERKAVETAAA
HGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLNVSVMLTNQSSSRRTVKLHLYLSVTYYT
GVTGTIFKETKKEVALAPGASDHVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAK
QHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVG
DIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPASGDRGLLSDAGGD
SHLGETIPMASRGGA
Download sequence
Identical sequences F6SSK0
ENSCJAP00000045743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]