SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046168 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000046168
Domain Number - Region: 259-302
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0418
Family Frizzled cysteine-rich domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046168   Gene: ENSCJAG00000012571   Transcript: ENSCJAT00000055366
Sequence length 366
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:61365293:61392966:1 gene:ENSCJAG00000012571 transcript:ENSCJAT00000055366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRGAWMWPGKDAAALTRAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADHLWLKELS
SAMRPPWGAGRERQRVPPRAMLPLPPPPPGEPSAPPGACGPRYSNLTICGGVPEPKGLDA
ACTKLQSLQRLFEPTTPAPPLRPPDSPSRAPAEFPSAKKNLLKGHFRNFTLSFCDTYTVW
DLLLGMDRPESLDCSLDTLLGDLLAVVASPGSGTWEACSNCIEAYQRLDRHAQEKYDEFD
LVLHKYLQAEEYSIRSCTKGCKAVYKAWLCSEYFSVTQQECQRWVPCKQYCLEVQTRCPF
LLPDNEEMVYGGLPGFICTGLLDTSPKRPETKCCDVQWVSCEAKKKKIKESEAPKTHHQQ
FHHSYF
Download sequence
Identical sequences F6VUG3
ENSCJAP00000046168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]