SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046211 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046211
Domain Number 1 Region: 23-130
Classification Level Classification E-value
Superfamily Lipocalins 3.41e-23
Family Retinol binding protein-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046211   Gene: ENSCJAG00000010456   Transcript: ENSCJAT00000055575
Sequence length 151
Comment pep:novel chromosome:C_jacchus3.2.1:1:179664600:179668166:1 gene:ENSCJAG00000010456 transcript:ENSCJAT00000055575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLLGVTLRLAAALSFTMKEEDITGTWYVKAVVTDKDLPEEKRPRKVSPVTVTALDHG
DLEATFTFMRNDRCFQKKILMRKTEAPGKFSIYGGRKLIYLQELPGREHYVFYCKDQRHG
GLFRMGELMGPWLSPFRICCLGSPGHLTCRS
Download sequence
Identical sequences F7C909
ENSCJAP00000046211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]