SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046290 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046290
Domain Number 1 Region: 107-139,220-294
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.04e-16
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046290   Gene: ENSCJAG00000016357   Transcript: ENSCJAT00000054015
Sequence length 349
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:76333955:76357892:1 gene:ENSCJAG00000016357 transcript:ENSCJAT00000054015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWRQNKTDAVIWVFTCIVSII
LGLDLGLLAGLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFS
SPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKNGQLRATKNGIVSDAGST
NNAFEPDEDIEDLEELDIPTKEIEIRVDWNSELPVKVNVPKVPIHSLVLDCGAISFLDIV
GVKSLRVIVKEFQRIDVNVYFASLQDHVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQN
QVKSQGGQDSILEAITFIQDCKDPLELIEAELTEEELDVQDEAMRTLAT
Download sequence
Identical sequences F7ASI9
ENSCJAP00000046290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]