SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046682 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046682
Domain Number 1 Region: 804-1091
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.93e-68
Family Protein kinases, catalytic subunit 0.0000322
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000046682
Domain Number - Region: 160-202
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00272
Family Heme-binding PAS domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046682   Gene: ENSCJAG00000006318   Transcript: ENSCJAT00000056482
Sequence length 1130
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:157637186:157679842:-1 gene:ENSCJAG00000006318 transcript:ENSCJAT00000056482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGFPDSARAGRRSPVDIVSRSGEKIPVSVWMKKMRQEHRLCCVVVLEPVERVSTWVAFQS
DGTVTSCDSLFAHLHGFVSGEDVAGRCITDLIPSLQLPPGQHIPKNLKIQRSVGRARDGT
TFPLSLKLKSEPSSEEVTTSEVAPLRDYWASVWVFCTISGLITLLPDGTIHGINHSFALM
LFGYGKSELLGKNITFLIPGFYSYMDLANDSSLQLPDLASCLDVSDKSGCGETTSDPWQG
QDPAEGSQDPRINVLAGGHVLPRDEARKLVGSGDVFTGTQTELGTGGRLPSCLSPQPAPG
VDSVAEGSPPAHGEQVLPEDQHTTASGREEPAAVETPGQGLLGGSRPEPVDAKPSASCED
SEAPGPAEDRGSNTGLCGLYQQAQLELTGVSGSDLWAGVAVAQPQAKGQLPVGSLPMHCP
CYRSEQGLWRRSQDLARSPSGVAGISLGTPTLDEPWLGVKNDQEELQTCLTKEELSELSL
VGALDIPHAELVPAECPAFTAPVLSCDLGGRDLYSGCTGSSSACYALATDLPRGLEEVQA
QEVDVNSFSWNLKELVSRDQTEQTSSNCSCAMSELGGTPSSSAVCSDPDVGGLQEQGPCI
LDDRELLLLTGTCVDLGQGRGFLESCLGHDPTEPSEVCSVSSEHYAASDRGSPGHFPSTL
DAGPENTCPSAEETTLDVQVTSTPVMPGAAGLQREIQEGAYSGSCHHRDGLRLSIRFEVR
RVELQGPSPLFCCWLVKDLLHSHRDSAARTCLLLASLPGSTHSTTAELTGPSLGEVLRAK
PWFEDAPKAVELEGLAACEGEYSQKYSTLSRLGSGAFGSVWTAVDKEQNKEVVVKFIKKE
KVLEDCWIEDPDLGKVPLEIAILSRVEHANIIKVLDVFQNHGFFQLVMEKHGSGLDLFAF
IDCHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYL
ERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAA
IHPPYLVSKELMSLVSGLLQPVPEKRTTLEKLVTDPWITQPVNLAEYTWEEVCQVNKPES
GVLSTASLEMGSRSLSEVAQAQALCAGPAPGEAPDGHGCLHPRDPRLLTS
Download sequence
Identical sequences F7IK51
ENSCJAP00000046682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]