SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046815 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046815
Domain Number 1 Region: 95-339
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.89e-65
Family G proteins 0.000000835
Further Details:      
 
Domain Number 2 Region: 415-520
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.7e-30
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00032
Further Details:      
 
Domain Number 3 Region: 316-411
Classification Level Classification E-value
Superfamily Translation proteins 1.59e-25
Family Elongation factors 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046815   Gene: ENSCJAG00000007678   Transcript: ENSCJAT00000057141
Sequence length 521
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:135453501:135540510:-1 gene:ENSCJAG00000007678 transcript:ENSCJAT00000057141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVSGKKQTMGFEVPGVTSEENGHSFHTPQKGPPSEDVSIAASDVLETASKSANPPHMIQ
ASEEQSLAPASMRKSGKLRQQIDVKVELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYL
LGNVNKRTMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVITLM
DAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAV
AVNKMDQVNWQQERFQEITGKLGHFLKQAGFKESDVAFIPTSGLSGENLITRSQSSELTK
WYKGLCLLEQIDSFKPPQRSIDKPFRLCVSDVFKDQGSGFCITGKIEAGYIQTGDRLLAM
PPNETCTVKGITLHDEPVDWAAAGDHVSLTLVGMDIIKINVGCVFCGPKEPIKACTRFRA
RILIFNIEIPITKGFPVLLHYQTVSEPAVIKRLISVLNKSTGEVTKKKPKFLTKGQNALV
ELQTQRPIALELYKDFKELGRFMLRYGGSTIAAGVVTEIKE
Download sequence
Identical sequences F7IS57
ENSCJAP00000046815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]