SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046955 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000046955
Domain Number - Region: 17-55
Classification Level Classification E-value
Superfamily Prefoldin 0.0262
Family Prefoldin 0.03
Further Details:      
 
Domain Number - Region: 97-168
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0345
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046955   Gene: ENSCJAG00000008104   Transcript: ENSCJAT00000055405
Sequence length 171
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:135306568:135323326:1 gene:ENSCJAG00000008104 transcript:ENSCJAT00000055405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRFFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNM
VKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAY
KQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAGWSSGG
Download sequence
Identical sequences A0A2K5EZT6 A0A2K6F3J0 F7I3H4
ENSCJAP00000046955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]