SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000046991 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000046991
Domain Number 1 Region: 4-200
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.13e-46
Family Adenylyltransferase 0.00000000976
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000046991   Gene: ENSCJAG00000002162   Transcript: ENSCJAT00000057574
Sequence length 215
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:17:36940675:37041137:1 gene:ENSCJAG00000002162 transcript:ENSCJAT00000057574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQVIQGIISPVNDNYGKKDLAASHHRVAMAQLALQTSNWIRVDPWESEQAQWMETVKVL
RHHHSELLRSPPQMEGPDHGKALSPTPAAVPELKLLCGADVLKTFHTPNLWKDAHIQEIV
EKFGLVCVGRVGHDPKGYISESPILRMHQHNIHLAKESVQNEISATYIRRALSQGQSVKY
LIPDAVITYIKDHGLYTKDSAWKGRSTQSTEGKTS
Download sequence
Identical sequences F7I134
ENSCJAP00000046991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]