SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047031 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047031
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 1.99e-39
Family Globins 0.000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047031   Gene: ENSCJAG00000000506   Transcript: ENSCJAT00000063659
Sequence length 154
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:198071913:198090811:-1 gene:ENSCJAG00000000506 transcript:ENSCJAT00000063659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNVWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASE
ELRKHGVTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIVHVLQKKH
PGDFGADAQGAMKKALELFRNDMAAKYKELGFQG
Download sequence
Identical sequences F6PMG4
XP_002743768.1.60252 XP_009008163.1.60252 XP_009008166.1.60252 ENSCJAP00000000863 ENSCJAP00000000863 ENSCJAP00000047031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]