SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047488 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047488
Domain Number 1 Region: 20-111
Classification Level Classification E-value
Superfamily Immunoglobulin 1.5e-43
Family V set domains (antibody variable domain-like) 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047488   Gene: ENSCJAG00000000003   Transcript: ENSCJAT00000062196
Sequence length 204
Comment pep:novel chromosome:C_jacchus3.2.1:10:131630877:131829877:-1 gene:ENSCJAG00000000003 transcript:ENSCJAT00000062196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFGLSWVFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMDWVRQAP
GKGLEWVSYINYNGGSTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTVPGHQVREMQ
REALHVRHPGCGRALQRSLHYSYSPTLMSLVLRAPTVTAPAGPRGPAPGFRSEPHVHTDR
PGQCLGHHLHLEALQWEDRCPGET
Download sequence
Identical sequences F7IDD4
ENSCJAP00000047488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]