SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047620 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047620
Domain Number 1 Region: 8-61
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00000106
Family Cna protein B-type domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000047620
Domain Number - Region: 297-349
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000549
Family Carboxypeptidase regulatory domain 0.019
Further Details:      
 
Domain Number - Region: 665-724
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00129
Family Cna protein B-type domain 0.01
Further Details:      
 
Domain Number - Region: 106-167
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0353
Family Rhamnogalacturonase B, RhgB, middle domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047620   Gene: ENSCJAG00000015952   Transcript: ENSCJAT00000055126
Sequence length 736
Comment pep:novel chromosome:C_jacchus3.2.1:12:16428721:16487140:1 gene:ENSCJAG00000015952 transcript:ENSCJAT00000055126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALK
EVITVVRVPRENAGGSPEVGSSRLASPTSRNPQEPLLQLFFFVFLHSLVTQAGDVLGCSV
SPVPGFQLQDESLVYLCYTVSREDGSFSFYSLPSGGYTTLSSRIPFYRGERITLDVARSR
LDFSVEHDSLKIEPRNLGFGVGSQIHLPPGGCGVKLESFGLHSIKLFLGTRAGRELHLFW
LIRAFPVIIESSCWNERSSLCRFSVCGQISIIRFPDTVKQMSKYKVVLSSQDKDKSLVTV
ETDAHGSFCFKAKPGTYKVQVIVPEAETRAGLTLKPQTFPLTVTDRPVMDVAFVQFLASV
SGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNSMTFTFDSVLPGRYKISIMHEDWC
WKNKSLEVEVLEDDVSGVEFRQTGYMLRCSLSHAITLEFYQDGNGRENVGIYNLSKGVNR
FCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIK
SSIDSEPALVLGPLKSVQELRREQQLAEIEARRQEREKNGKEEGEERMTKPPVQEMVDEL
QGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEAIVSGESCPGKLIEIHGKAGLFLEG
QIHPELEGVEIIISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTSQKEGYVLTAVEG
TVGDFKAYALAGVSFE
Download sequence
Identical sequences F7H2P5
ENSCJAP00000047620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]