SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047621 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047621
Domain Number 1 Region: 23-137
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.55e-38
Family Frizzled cysteine-rich domain 0.0000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047621   Gene: ENSCJAG00000016150   Transcript: ENSCJAT00000057971
Sequence length 706
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:91184464:91213639:-1 gene:ENSCJAG00000016150 transcript:ENSCJAT00000057971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMFTFWLTCIFLPLVRGHSLFTCEPITVPRCMEMAYNMTFFPNLLGHYDQSIAAVEMKH
FLPLAKLKCSPNVETFLCKAFVPTCTEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEE
LECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSNELEFAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTILFMLLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVALLGCYIYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSVREM
RGDGASTPRLREQDCGEPASPAASSSRLSGEQVERKGQAGSVSEGARSEGRISPKSDITD
TDRAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRREQGGGCHSDT
Download sequence
Identical sequences F7H2P3
ENSCJAP00000047621 XP_008981636.1.60252 ENSCJAP00000029741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]