SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047786 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047786
Domain Number 1 Region: 4-386
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.29e-55
Family GDI-like N domain 0.000000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047786   Gene: ENSCJAG00000010392   Transcript: ENSCJAT00000059102
Sequence length 386
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:76251141:76437107:-1 gene:ENSCJAG00000010392 transcript:ENSCJAT00000059102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTLPSEFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLK
EYQENSDIVNDSPVWQYHILENEEAIALSRKDKTIQHVEVFCYASQDLHEDVEEAGALQK
NHALVTSTNSTEAADSACLPTEDESLSTVSCEMLIEQTPSSDPESALEVNGAEVTGEKEN
HSDDKTCVPSTSAEEMSDNVPIAEDTTEQPKKNKITYSQIIKEGRRFNIDLVSKLLYSRG
LLIDLLIKSNVSRYAEFKNITRILAFRDGRVEQVLLADPGFFTAQTTSMVEKRMLMKFTF
CMEYEKFDEYKGYEEITFCEYLKTQKLTPNLQYIVLHSIAMTSQTASSTIDGLKATKNFL
HCLGRYGNTPFLFPLYGQGELPQCFC
Download sequence
Identical sequences F7E2S5
ENSCJAP00000047786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]