SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047860 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047860
Domain Number 1 Region: 250-559
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.21e-116
Family Transglutaminase core 0.0000000186
Further Details:      
 
Domain Number 2 Region: 99-249
Classification Level Classification E-value
Superfamily E set domains 4.55e-45
Family Transglutaminase N-terminal domain 0.00011
Further Details:      
 
Domain Number 3 Region: 573-684
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.5e-31
Family Transglutaminase, two C-terminal domains 0.00055
Further Details:      
 
Domain Number 4 Region: 685-784
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.09e-29
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047860   Gene: ENSCJAG00000006740   Transcript: ENSCJAT00000052909
Sequence length 813
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:48287710:48302502:-1 gene:ENSCJAG00000006740 transcript:ENSCJAT00000052909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGHVPTWAVGVGTWHPPSTPSPSPEPEPERRSRRGGRSFWARCCGCCSCRNAADDDWGPE
PSDSRDRGSSSGTRRPGSRGSDSRRPISRGSGVNAAGDGTIREGMLVVTGVDLMSLRSDR
NRREHHTDEYEYDELIVRRGQPFHVLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIP
VGKGGSGGWKAQVVKANGQNLNLRVHTSPSAIIGKFQFTVRTQSDAGEFQLPFDPRNEIY
ILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYI
LDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLS
YLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPL
EHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGL
VYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLVVTKAIGSNMREDITYLY
KHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLNVSVMLTNQS
SSRRTVKLHLYLSVTYYTGVTGTIFKETKKEVALAPGASDHVTMPVAYKEYRPHLVDQGA
MLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNV
VFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQV
DVAPASGDRGLLSDAGGDSHLGETIPMASRGGA
Download sequence
Identical sequences F7GS12
ENSCJAP00000047860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]