SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000047939 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000047939
Domain Number 1 Region: 1-307
Classification Level Classification E-value
Superfamily SIS domain 6.36e-82
Family double-SIS domain 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000047939   Gene: ENSCJAG00000019141   Transcript: ENSCJAT00000057521
Sequence length 307
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:37575519:37595562:1 gene:ENSCJAG00000019141 transcript:ENSCJAT00000057521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGL
RYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMC
DDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCL
EGALKMEVAANLHSIXXXXGLKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQG
RPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNL
AKSVTVE
Download sequence
Identical sequences F7EFK8
ENSCJAP00000047939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]