SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048159 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048159
Domain Number 1 Region: 573-603,642-720
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.32e-16
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048159   Gene: ENSCJAG00000021099   Transcript: ENSCJAT00000060531
Sequence length 740
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:47429890:47434683:1 gene:ENSCJAG00000021099 transcript:ENSCJAT00000060531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEGKEQHDLSPRDSAEGNDLSSPSGIHLELQRESSTDFKQFETNDQCRPYPRILIERQ
EKSNTNFKQFVIKKLQKNCQCNPTKAKNMILGFLPVLQWLPKYDLKKNILGDVMSGLIVG
ILLVPQSIAYSLLAGQEPVYGLYTSFFASIIYFLLGTSRHISVGIFGILCLMIGETVDRE
LQKAGYDNAHSAPSLGMVSNGSTLLNQTSDRICDKSCYAIMVGTTVTFMAGVYQVAMGFF
QVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLNLPRSNGVGSLITTWIHIFRNIRE
TNPCDLITSLLCLLVLLPTKELNEHFKSKLKAPIPVELVVVVAATLASHFGKLHETYNSS
VAGHIPTGFMPPRVPEWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVRANQEMY
AIGFCNIIPSFFHCFTTSAALAKTLVKESTGCQTQLSGVVTALVLLLVLLVIAPLFYSLQ
KSVLGVITIVNLRGALRKFRDLPKMWSISRMDTVIWFVTMLSSALLSTEIGLLVGVCFSM
FCVILRTQKPKISLLGLVEGSEVFESLSAYKNLQTKPGIKIFRFVAPLYYINKECFKSAL
YKQTVNPVLIKAAWKKAAKRKVKEEVVTLGGIQDEVSVQLSHDSLELNTIVIDCSAIQFL
DTAGIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLTKGEYCQKEEENLLFYSVYEAMAFA
EASKNQKGICVPNGLSLSSD
Download sequence
Identical sequences F7H3N7
XP_002744409.1.60252 XP_008985994.1.60252 ENSCJAP00000039259 ENSCJAP00000048159 ENSCJAP00000039259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]