SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048166 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048166
Domain Number 1 Region: 485-704,731-832
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.39e-65
Family Pancreatic carboxypeptidases 0.0000055
Further Details:      
 
Domain Number 2 Region: 309-466
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.18e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00029
Further Details:      
 
Domain Number 3 Region: 832-924
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.28e-21
Family Carboxypeptidase regulatory domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048166   Gene: ENSCJAG00000007936   Transcript: ENSCJAT00000061010
Sequence length 1082
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:11615853:11624332:1 gene:ENSCJAG00000007936 transcript:ENSCJAT00000061010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RESASWTVPPEKTKDKGKKGKKDKGPKVPKLSLEGSPKPPKKGKEKPPKATKKPKEKPPK
ATKKPKEKPPKATKKPKEKPPKATKKPLSGKSPPTLAPSETLEWPLPSPPSPGPEELPQE
GGLCPASNNWQGPGEEAREHQPEPEEETELPTLDYNDQIEREDYEDFEYVRRQKRPRPPP
SRRRRPERVWPEPPEEKAPAPAPEEKTGRMGGRGGXXXXLPPLPPDYGDGYVIPNFDDMD
YYFGPPPPQKPDAERQTDEEKEKLKKPKKEDGSPKEETDKWAVEKGKDHKEPRKGEEVEE
EWTPTEKVKCPPIGMESHRIEDNQIRASSMLRHGLGAQRGRLNMQAGATEDDYYDGAWCA
EDDARTQWIEVDTRRTTRFTGVITQGRDSSIHDDFVTTFFVGFSNDSQTWVXXXXXXXXX
XPFMECDKDTPVLSELPEPVVARFIRIYPLTWNGSLCMRLEVLGCAVAPVYSYYAQNEVV
ATDDLDFRHHSYKDMRQLMKLVNEECPTITRTYSLGKSSRGLKIYAMEISDNPGEHELGE
PEFRYTAGIHGNEVLGRELLLLLMQYLCREYRDGNPRVRSLVQDTRIHLVPSLNPDGYEV
AAQMGSEFGNWALGLWTEEGFDIFEDFPDLNSVLWGAEERKWVPYRVPNNNLPIPERYLS
PDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVSYPYDMARTPTEEQLLAAAMAAARGE
DEDEVSEAQETPDHAVFRWLAISFASAHLTLTEPYRGGCQAQDYTGGMGIVNGAKWNPRS
GTINDFSYLHTNCLELSFYLGCDKFPHESELPREWENNKEALLTFMEQVHRGIKGVVTDE
QGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGA
TQCNFILARSNWKRIREIMAMNGNRPIPRIDPSRPMTPQQRRLQQRRLQHRLRLRAQMRL
RRLNATTTLDPHTVPTTLPPAPATTLSTTMEPWGVVPPTTAGWEEWETETYTEVVTEFGT
EVEPKFETQLEPEFGTEVEPEFETQLETEFEEEEEEEEEEMATGQAFPFTTVETYTVNFG
DF
Download sequence
Identical sequences F7H3J0
ENSCJAP00000014686 ENSCJAP00000048166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]