SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048203 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048203
Domain Number 1 Region: 125-319
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.3e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048203   Gene: ENSCJAG00000002528   Transcript: ENSCJAT00000055182
Sequence length 322
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:118048564:118087085:-1 gene:ENSCJAG00000002528 transcript:ENSCJAT00000055182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGSLAAGALKQKLVPLVRTVCVRSPRHRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDNSVLVLIVGLSTVGAGAYAYKTIKEDQKRYEERISGMGLTPEERQTRAELSATGE
PVSQVRAPNHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWF
SDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRGN
MVKLNDVYQITYEKCXXPGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKS
ITIIGGGFLGSELACALGRKAV
Download sequence
Identical sequences F7FQ73
ENSCJAP00000048203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]