SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048257 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000048257
Domain Number - Region: 169-198
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.036
Family Inositol polyphosphate kinase (IPK) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048257   Gene: ENSCJAG00000020415   Transcript: ENSCJAT00000040080
Sequence length 199
Comment pep:novel chromosome:C_jacchus3.2.1:7:599435:600318:1 gene:ENSCJAG00000020415 transcript:ENSCJAT00000040080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMLSTLDAKMWILSTLDTKMWILSTLDTKIKALSTLDTKMLKVFTLDTKMWILSTLDTRT
LMLSTLDSKMWILSTLDTKTLMLSRLDTKMWILSTLDTKTSILSTLDTKMWILSTLDDTE
TLMLSTLDTKMWILSTLDTKTLMLSTLDTKMWILSTLDTKMSMLSTLDTKTWILSTLYTK
TSVPSALDTKMGVSCWHPL
Download sequence
Identical sequences F7E5P7
ENSCJAP00000048257 ENSCJAP00000048257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]