SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048472 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048472
Domain Number 1 Region: 16-387
Classification Level Classification E-value
Superfamily Translation proteins 1.68e-112
Family Ribosomal protein L3 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048472   Gene: ENSCJAG00000016276   Transcript: ENSCJAT00000061884
Sequence length 419
Comment pep:novel scaffold:C_jacchus3.2.1:GL284753.1:4414:11884:-1 gene:ENSCJAG00000016276 transcript:ENSCJAT00000061884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGGEERARKWRSSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLG
YKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAE
HISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQM
RLLPLRQKKAHLMEIQVNGGTVSEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGY
KGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIG
QGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLR
KSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKKPPTEGIV
Download sequence
Identical sequences H9KYC2
ENSCJAP00000048472 ENSCJAP00000048472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]