SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048506 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048506
Domain Number 1 Region: 149-305
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-26
Family Dual specificity phosphatase-like 0.026
Further Details:      
 
Domain Number 2 Region: 16-122
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000000000245
Family Starch-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048506   Gene: ENSCJAG00000019389   Transcript: ENSCJAT00000058605
Sequence length 331
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:146322395:146413444:-1 gene:ENSCJAG00000019389 transcript:ENSCJAT00000058605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPGGAVLMRPAGTAAGAGSRALQEPGLW
IGEVELVAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNESNLVDG
VYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKL
KHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTADTMIKLYKEEGLAYIWMPTPDMSTEG
RVQMLPQAVCLLHALLENGHTVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLLAKR
PAVYIDEEALARAQEDFFQKFGKVHSSLCSL
Download sequence
Identical sequences F7GDH7
ENSCJAP00000036002 XP_002747109.1.60252 ENSCJAP00000048506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]