SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048534 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048534
Domain Number 1 Region: 289-380
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0000379
Family Rad50 coiled-coil Zn hook 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000048534
Domain Number - Region: 546-619
Classification Level Classification E-value
Superfamily Spectrin repeat 0.023
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048534   Gene: ENSCJAG00000033428   Transcript: ENSCJAT00000059741
Sequence length 783
Comment pep:known_by_projection scaffold:C_jacchus3.2.1:ACFV01177304.1:2835:32583:-1 gene:ENSCJAG00000033428 transcript:ENSCJAT00000059741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVKERQERETK
TANQLMAINDFAEKETLKQKQIDEIRDKKTGLGRIIELKSEILSKKQNELKNVKYELQQL
EGSSDRILELDQELIKAERELSKAEKNSNVETLKMEVINLQNEKADIDRTLRKLDQEMEQ
LNHHTTTRTQMEMLTKDKADKDEQIRKIKSRHSDELTSLLGYFPNKKQLEDWLHSKSKEI
NQTRDRLAKLNKELASAEQNKNHINNELKRKEEQLSSYEDKLFDVCGSQDFDSDLDRLKE
EIEKSSKQRAMLAGATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISDLQSKLRL
APDKLKSTESELKKKEKRRDEMLGLVPMRQSIIDLKEKEIPELRNKLQNVNRDIQRLKND
IEEQETLLGTIMPEEESAKMCLTDVTIMERFQMELKDVERKIAQQAAKLQGIDLDRTVQQ
VNQEKQEKQHKLDTVSSKIELNRKLIQDQQEQIQHLKSTTNELKSEKLQISTNLQRRQQL
EEQTVELSTEVQSLYREIKDAKEQVSPLETTLEKFQQEKEELINKKNTSNKIAQDKLNDI
KEKVKNIHGYMKDIENYIQDGKDDYKKQKETELNKVIAQLSECEKHKEKINEDMRIMRQD
IDTQKIQERWLQDNLTLRKRNEELKEVEEERKQHLKEMGQMQVLQMKNEHQKLEENIENI
KRNHNLALGRQKGYEEEIIHFKKELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKT
LDQ
Download sequence
Identical sequences H9KYC4
ENSCJAP00000048534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]