SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048654 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048654
Domain Number 1 Region: 66-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048654   Gene: ENSCJAG00000008953   Transcript: ENSCJAT00000062020
Sequence length 893
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:65156969:65165861:1 gene:ENSCJAG00000008953 transcript:ENSCJAT00000062020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTDGATVKAAGLGPLVSGATVQTGPLPTLVSGGTILATVPLVVDADKLPINRLAAGSKA
PGSAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQ
HSNQKLKQENLSLRTAVHKSKSLKDLVLACGGGGSTDVLMEGVKTEVEDTLTPPPSDAGS
PFQSSPLSLGSRGSGSGGSGSDSEPDSPVFDDSQAKPEQRPTAHSGGMLDRSRLALCTLV
FLCLSCNPLASLLGARGLPSPSETTSIYHIPGRNVLGTESRDGPGWAQWLLPPVVWLLNG
LLVLVSLVLLFVYGEPVTRPHSDPAVHFWRHRKQADLDLARGDFAQAAQQLWLALRALGR
PLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQRDCSLRVDARASARDAALVYH
KLHQLHTMGKYTGGHLTATNLALSALNLAECAGDAVSVVTLAEIYVVAALRVKTSLPRAL
HFLTRFFLSSARQVCLAQSGSVPLAMQWLCHPVGHRFFVDGDWAVLSTPRESLYSLAGNP
VDPLAQVTQLFREHLLERALNCVAQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPT
CSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAEQLCPLVEHLPRVLQESERP
LPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTPAGSSLDKAVQLFLC
DLLLVVRTSLWHQQQPPAPAPAGQGASSGPQASALELRGFQRDLSSLRRLAQSFRPAMRR
VFLHEATARLMAGASPARTHQLLDRSLRRRAGPGGKGGVATELEPRPTRREHAEALLLAS
CYLPPGFLSAPGQRIGMLAEAARTLEKLGDRRLLHDCQQMLMRLGGGTTVTYS
Download sequence
Identical sequences F6T0K1
ENSCJAP00000048654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]