SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048656 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048656
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.22e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048656   Gene: ENSCJAG00000019202   Transcript: ENSCJAT00000062055
Sequence length 577
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:86715836:86772164:1 gene:ENSCJAG00000019202 transcript:ENSCJAT00000062055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLA
KRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDM
KMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVP
LYNDVMLPSSNEKLQNINLSMSPLATSETPKPLRSSADPALNQEVALKLEPNPESLELSF
TMPQIQDQPPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNP
FSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQE
LTSNATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASP
NRAGKGVIEQTEKSHPRSPNVLSVALSQRATVPEEELNPKILALQNAQRKRKIEHDGSLF
QAVGIGTLLQQPDDHATTTSLSWKRVKGCKSSEQNGMEQKAIILIPSDLACRLLGQSMDE
SGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences F6T0I4
ENSCJAP00000048656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]