SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048795 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048795
Domain Number 1 Region: 646-992
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.68e-91
Family PDEase 0.00000805
Further Details:      
 
Domain Number 2 Region: 459-641
Classification Level Classification E-value
Superfamily GAF domain-like 6.32e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 290-472
Classification Level Classification E-value
Superfamily GAF domain-like 2.18e-33
Family GAF domain 0.0000000198
Further Details:      
 
Domain Number 4 Region: 112-262
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000033
Family GAF domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048795   Gene: ENSCJAG00000015101   Transcript: ENSCJAT00000052884
Sequence length 1004
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:66162901:66246016:1 gene:ENSCJAG00000015101 transcript:ENSCJAT00000052884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQKKKMPGTCLPGGGTTYELPSPSLHPSSVPVTSGGTCPALLAEGWEAPIMAFIESGSAV
GPSWTHRGHSRSSSEAELRRRRRGPWSLPSGAEGTAGPSHPPPLPRPLGCPLQDALLSLG
SVIDVSGLQRAVKEALSAVLPRVETVYTYLLDGESRLVCEDPPHELPQEGKVREAVISRK
RLDCNGLGLSDLPGKALARLVAPLAPDTQVLVIPLADKEAGAVAAVILVHCGQLSDSEEW
SLQAVERHTLVALRRVQALQQRGPSEAPRAIQNPPEGAAEDQKDGAAYTDRDRKILQLCG
ELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGC
LGQVVEDKKSIQLKDLTSEDVQQLQSMLGCELQAVLCVPVISRATDQVVALACAFNKLEG
DLFTDHDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQ
EIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQI
LNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDED
LATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAA
IDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPY
HNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVL
AALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLR
IFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGD
LVCVEMVSISRRHDPPASASQSAGITGVSHCTQPILLLQDLFPKAAELYERVASNREHWT
KVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCIDAE
Download sequence
Identical sequences F6Q8H8
ENSCJAP00000048795 ENSCJAP00000027860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]