SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049183 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049183
Domain Number 1 Region: 83-147
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0000000000112
Family Crotonase-like 0.0000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049183   Gene: ENSCJAG00000032208   Transcript: ENSCJAT00000060884
Sequence length 160
Comment pep:novel scaffold:C_jacchus3.2.1:ACFV01190878.1:2204:3394:1 gene:ENSCJAG00000032208 transcript:ENSCJAT00000060884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVATAPGTLGSLHAGGVRLVAACNARLAGLRFPGSLAGRRVGPAIWAQSWVPVAGGP
APRRGYSSEVKTEDELRVRHLEDENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSD
KKVRTIIIRSEVPGIFRAGADLKERAKHLEWTHLCTSLKY
Download sequence
Identical sequences H9KYD6
ENSCJAP00000049183 ENSCJAP00000049183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]