SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049221 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049221
Domain Number 1 Region: 48-113
Classification Level Classification E-value
Superfamily SNARE fusion complex 3.61e-23
Family SNARE fusion complex 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049221   Gene: ENSCJAG00000009661   Transcript: ENSCJAT00000061021
Sequence length 141
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:34920654:34971627:1 gene:ENSCJAG00000009661 transcript:ENSCJAT00000061021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQV
DEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIM
ALVAAILLLVIIILIVMKYHT
Download sequence
Identical sequences A0A2K5DYD2 A0A2K5SCY7 F6W2F6
ENSCJAP00000049221 XP_002760414.1.60252 XP_004626863.1.9945 XP_012299946.1.9421 XP_017385502.1.71028 ENSCJAP00000049221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]