SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049485 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049485
Domain Number 1 Region: 182-259
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.28e-22
Family Intermediate filament protein, coiled coil region 0.00063
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000262
Family Intermediate filament protein, coiled coil region 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049485   Gene: ENSCJAG00000033114   Transcript: ENSCJAT00000055093
Sequence length 259
Comment pep:novel chromosome:C_jacchus3.2.1:1:131039905:131040820:-1 gene:ENSCJAG00000033114 transcript:ENSCJAT00000055093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NEKETMQSLNDRLASYLDRVRSLETKNWKLEGEIREHLGKGPQIDNAHLAPDDFRVKYQT
ELAMCQSVESDIHGLRKVINDTNVTRLQLETEIEALKEELLFMKKNHEEKVKGLPAQTAS
SGLTVEVNTRPHQDHSRNQGSVGQAGWEEPEELDNPRLSSTEDEAAEMMLTEPRRSVQSL
EIDLDSMRNTKISLENSLGEMEACYTLQMEQLKGILLLLESELAQTRAEGQRQAQEYEDL
LNIKVNLEAEIATYRRLLE
Download sequence
Identical sequences F7AFR5
ENSCJAP00000049485 ENSCJAP00000049485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]