SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049788 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000049788
Domain Number - Region: 355-417
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0389
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049788   Gene: ENSCJAG00000006632   Transcript: ENSCJAT00000057360
Sequence length 466
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:105307772:105339462:1 gene:ENSCJAG00000006632 transcript:ENSCJAT00000057360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIQEHPSLSDTKQQRNQDAGDQQESFVSEVPQLDLTALCDEKNWEEPIPAFSSWQRENS
DSDEARLSPQAGRLIRQLLDEDSDPMLSPRFYAYGQSRQYLDDTEVPPSPPNAHSFMRRR
SSSLGSYDDEQEDLTPAQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKAANPEVLKWT
NDLAKFRRQLKESKLKISEEDLTPRMRQRSNTLPKSFGSQLEKEDEKKQELADKAIKPSV
EATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQ
VMKPLYDRYRLVKQILSRANTIPIIEEEEGSEDDSNTKPDFMVTLKTDFSARCLLDQFED
DADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMKEEKKRIRKKLRDFEDNFF
RQNGRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLISKRDTDSKSM
Download sequence
Identical sequences F7CBT4
ENSCJAP00000049788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]