SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000049980 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000049980
Domain Number 1 Region: 536-603
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000049980   Gene: ENSCJAG00000004038   Transcript: ENSCJAT00000062753
Sequence length 647
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:93213412:93579141:-1 gene:ENSCJAG00000004038 transcript:ENSCJAT00000062753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRNYGDGTPYDHMTSRD
LGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLSPTKP
GSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSS
KPTTSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSNSYCSLHPHERLS
YPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDAL
GKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQS
RIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSA
NRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQ
SVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPEQKAE
REKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQ
VRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences F7BD24
XP_017818976.1.60252 ENSCJAP00000049980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]