SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050016 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050016
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-33
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 176-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-18
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 3 Region: 298-334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000123
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050016   Gene: ENSCJAG00000007534   Transcript: ENSCJAT00000060087
Sequence length 527
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:20:534413:584307:-1 gene:ENSCJAG00000007534 transcript:ENSCJAT00000060087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRMSKVCCKKQVLLITVLVVEGIAVAQKTQDGQNIGIKHVPATQCGIWVRTSNGGHFASP
NYPDSYPPNKECIYILEAAPRQRIELTFDERYYIEPSFECRFDHLEVRDGPFGFSPLIDR
YCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPVTDPDFTYLGGILNPIPDCQ
FELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNF
VAVYDGSSSIENLKAKFCSTVANDVMLKTGIGVIRMWADEGSRLSRFRMLFTSFVEPPCT
GSTFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGITSGIV
LVLLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISTDLADLSEE
LDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTF
KKSSYTFKQGHDCPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Download sequence
Identical sequences F7FS53
ENSCJAP00000050016 ENSCJAP00000050016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]