SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050113 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000050113
Domain Number - Region: 120-244
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0654
Family Apolipophorin-III 0.0025
Further Details:      
 
Domain Number - Region: 271-320
Classification Level Classification E-value
Superfamily Globin-like 0.0834
Family Phycocyanin-like phycobilisome proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050113   Gene: ENSCJAG00000013807   Transcript: ENSCJAT00000062094
Sequence length 459
Comment pep:novel scaffold:C_jacchus3.2.1:ACFV01185297.1:309:4456:1 gene:ENSCJAG00000013807 transcript:ENSCJAT00000062094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKINQHMSAFFLKDFKISIFNYRLILQQQEEKRRKPEKYEKGIEKFKIMEEQYWTQARVK
NLLKLTHKSLNIELKTVRNNLNQSSFTHEKERDLWQKNHLMRVEIARLRLEIDTIKHQNQ
EIENMYFKDIEIIKKKNEDLEKTLKLNEETLTKTINWYSEELNGLTLDKNTVLNSELEKE
KQRKQRLETELELYSRRLAAALCDRDQSQSSKRDLQLAFQNTVNQWCHLQENMNSHIQIL
SQQLSKAESKSRGLETELHCEREALKEKTLAIEHMQGVISQAQCRMKAFEHMYQNDQHIV
EKYVRKQQSVQDGLFQIQSQNSLHQQQLNDAHKKADNQEKTIIDIQAKCEDTVEKLQAEC
RKHCILLEENNKGLIEEYTLLKERQCQYEKEKEEGQVSIKKIVRKLKRELGDVLNKQSLA
EGMLEISSQRQNMLEDTKKKLELMRSQVCMKLSLSTVTL
Download sequence
Identical sequences H9KYG0
ENSCJAP00000050113 ENSCJAP00000025390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]